PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast01G030100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NF-YB
Protein Properties Length: 123aa    MW: 13345 Da    PI: 10.3748
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast01G030100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB1085.9e-341791795
               NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95
                        mk +lPa+ak+sk ake +qec++ef++fvt+eas++c+re+rkt++gdd+++a+ +lG+++y++++  yl+++re+e+
  Brast01G030100.1.p  1 MKGALPAEAKVSKRAKEAIQECATEFVAFVTGEASQRCRRERRKTVSGDDVCHAMRSLGLDHYAAAMARYLQRHREAEE 79
                        899*************************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.106.0E-32188IPR009072Histone-fold
PfamPF008083.8E-15155IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
SuperFamilySSF471131.59E-24192IPR009072Histone-fold
PRINTSPR006154.3E-111937No hitNo description
PRINTSPR006154.3E-113856No hitNo description
PRINTSPR006154.3E-115775No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 123 aa     Download sequence    Send to blast
MKGALPAEAK VSKRAKEAIQ ECATEFVAFV TGEASQRCRR ERRKTVSGDD VCHAMRSLGL  60
DHYAAAMARY LQRHREAEEL AAQINGRSGG FGQQIDVRAQ LSSVSSRSRA PGSSETKHLG  120
RN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B4e-281761792Transcription factor HapC (Eurofung)
4g92_B4e-281761792Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015690868.16e-49PREDICTED: transcriptional activator hap3-like
SwissprotO822483e-33NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLA0A0Q3N4201e-62A0A0Q3N420_BRADI; Uncharacterized protein
TrEMBLI1HUZ23e-62I1HUZ2_BRADI; Uncharacterized protein
STRINGBRADI2G60030.19e-62(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29173887
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.13e-34nuclear factor Y, subunit B5